PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang06g13670.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 292aa    MW: 32099.9 Da    PI: 7.4404
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang06g13670.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.72.1e-115092246
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     g ++++Ed ++  ++   G++ W+ Ia+ ++ gRt++++k++w++
   Vang06g13670.1 50 GEFSEDEDRIICTLFGSIGSR-WSIIASQLP-GRTDNDIKNYWNT 92
                     789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.171243IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.605.2E-72246IPR009057Homeodomain-like
SuperFamilySSF466893.12E-202998IPR009057Homeodomain-like
PROSITE profilePS5129421.0794498IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-224798IPR009057Homeodomain-like
SMARTSM007172.0E-114896IPR001005SANT/Myb domain
PfamPF002493.3E-105092IPR001005SANT/Myb domain
CDDcd001677.55E-85194No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MVQVETGFPS HIKLFGEIRP KVSKWSGLKR CGKSCRLRWL NYLRPNLKHG EFSEDEDRII  60
CTLFGSIGSR WSIIASQLPG RTDNDIKNYW NTKLKKKMMG IMNPSALKKP HQVTLSSMLQ  120
NSTPSTSSSS SLSLKRNHSS NHQPHGPFTS PDTISYESLL SGNSCSTFES LYQVNCGFML  180
ETSCSSSSDG SCNNNNQMNH VKGAEVGDVG VGGFGDQIGG LSYLSSGVED TQKLVSSNGG  240
RTSGWTGEES RLWGESPLEY GLEEIKELMS TSSCNNFMFD DSKTGEMVMY Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-19129816105MYB PROTO-ONCOGENE PROTEIN
1msf_C4e-19129816105C-Myb DNA-Binding Domain
1mse_C4e-19129816105C-Myb DNA-Binding Domain
1h8a_C5e-19109840128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014512645.11e-158PREDICTED: transcription factor RAX2
TrEMBLA0A0L9TXD20.0A0A0L9TXD2_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SR880.0A0A0S3SR88_PHAAN; Uncharacterized protein
STRINGGLYMA13G20510.11e-126(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.14e-42myb domain protein 36